Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHC PTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE DDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDED EGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTY DLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENH PHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVH
    • Molecular weight

      33 kDa
    • Amino acids

      1 to 287

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab152071 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as a 0.2 µM filtered solution.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

General Info

  • Alternative names

    • 2610016C12Rik
    • Apg 3
    • APG3
    • APG3 autophagy 3 like
    • APG3 like
    • APG3, S. cerevisiae, homolog of
    • APG3-like
    • APG3L
    • Apg3p
    • ATG 3
    • ATG3
    • ATG3 autophagy related 3 homolog
    • ATG3 autophagy related 3 homolog (S. cerevisiae)
    • ATG3_HUMAN
    • Autophagy 3, S. cerevisiae, homolog of
    • Autophagy Apg3p/Aut1p like
    • autophagy related 3
    • Autophagy related protein 3
    • Autophagy-related protein 3
    • DKFZp564M1178
    • FLJ22125
    • hApg3
    • MGC15201
    • OTTHUMP00000214547
    • OTTHUMP00000214548
    • PC3 96
    • Protein PC3-96
    • Ubiquitin-like-conjugating enzyme ATG3
    see all
  • Function

    E2-like enzyme involved in autophagy and mitochondrial homeostasis. Catalyzes the conjugation of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A) to phosphatidylethanolamine (PE). PE-conjugation to ATG8-like proteins is essential for autophagy. Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3.
  • Tissue specificity

    Widely expressed, with a highest expression in heart, skeletal muscle, kidney, liver and placenta.
  • Sequence similarities

    Belongs to the ATG3 family.
  • Post-translational
    modifications

    Conjugated to ATG12 at Lys-243. ATG12-conjugation plays a role in regulation of mitochondrial homeostasis and cell death, while it is not involved in PE-conjugation to ATG8-like proteins and autophagy.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab152071 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up