Overview

  • Product name

    Recombinant Human ATMIN protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MKMHAEKKHKCSKCSNSYGTEWDLKRHAEDCGKTFRCTCGCPYASRTALQ SHIYRTGHEIPAEHRDPPSKKRKMENCAQNQKLSNKTIESLNNQPIPRPD TQELEASEIKLEPSFEDSCGSNTDKQTLTTPPRYPQKLLLPKPKVALVKL PVMQFSVMPVFVPTADSSAQPVVLGVDQGSATGAVHLMPLSVGTLILGLD SEACSLKESLPLFKIANPIAGEPISTGVQVNFGKSPSNPLQELGNTCQKN SISSINVQTDLSYASQNFIPSAQWATADSSVSSCSQTDLSFDSQVSLPIS VHTQTFLPSSKVTSSIAAQTDAFMDTCFQSGGVSRETQTSGIESPTDDHV QMDQAGMCGDIFESVHSSYNVATGNIISNSLVAETVTHSLLPQNEPKTLN QDIEKSAPIINFSAQNSMLPSQNMTDNQTQTIDLLSDLENILSSNLPAQT LDHRSLLSDTNPGPDTQLPSGPAQNPGIDFDIEEFFSASNIQTQTEESEL STMTTEPVLESLDIETQTDFLLADTSAQSYGCRGNSNFLGLEMFDTQTQT DLNFFLDSSPHLPLGSILKHSSFSVSTDSSDTETQTEGVSTAKNIPALES KVQLNSTETQTMSSGFETLGSLFFTSNETQTAMDDFLLADLAWNTMESQF SSVETQTSAEPHTVSNF
    • Molecular weight

      99 kDa including tags
    • Amino acids

      1 to 667

Specifications

Our Abpromise guarantee covers the use of ab132268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ASCIZ
    • ATM INteracting protein
    • ATM interactor
    • ATM substrate CHK2-interacting zinc finger protein
    • ATM/ATR substrate CHEK2 interacting zinc finger protein
    • ATM/ATR Substrate Chk2 Interacting Zn++ finger protein
    • ATM/ATR substrate Chk2 interacting Zn2+ finger protein
    • ATM/ATR-substrate CHK2-interacting zinc finger protein
    • ATMIN
    • ATMIN_HUMAN
    • DKFZp779K1455
    • FLJ76795
    • KIAA0431
    • Zinc finger protein 822
    • ZNF 822
    • ZNF822
    see all
  • Function

    Plays a crucial role in cell survival and RAD51 foci formation in response to methylating DNA damage. Involved in regulating the activity of ATM in the absence of DNA damage. May play a role in stabilizing ATM.
  • Tissue specificity

    Ubiquitously expressed in normal tissues and cancer cell lines with highest levels in placenta and skeletal muscle.
  • Sequence similarities

    Contains 2 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus. Nuclear, in discrete foci during G1 phase.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132268 stained with Coomassie Blue.

References

ab132268 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up