Description

  • Product name

    Recombinant Human ATOH8 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAP EPRAVATNGLRDRTHRLQPVPVPVPVPVPVAPAVPPRGGTDTAGERGGSR APEVSDARKRCFALGAVGPGLPTPPPPPPPAPQSQAPGGPEAQPFREPGL RPRILLCAPPARPAPSAPPAPPAPPESTVRPAPPTRPGESSYSSISHVIY NNHQDSSASPRKRPGEATAASSEIKALQQTRRLLANARERTRVHTISAAF EALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSADHSNLSFS ECVQRCTRTLQAEGRAKKRKE
    • Amino acids

      1 to 321
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Protein atonal homolog 8

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4933425C05Rik
    • ATOH8
    • ATOH8_HUMAN
    • Atonal homolog 6
    • Atonal homolog 8
    • atonal homolog 8 (Drosophila)
    • Basic helix loop helix transcription factor 6
    • bHLHa21
    • Class A basic helix-loop-helix protein 21
    • FLJ14708
    • FLJ38730
    • hATH6
    • Helix loop helix protein mATH-6
    • Helix-loop-helix protein hATH-6
    • Math6
    • Okadin
    • Protein atonal homolog 8
    • RGD1561512
    see all
  • Function

    Putative transcription factor. May be implicated in specification and differentiation of neuronal cell lineages in the brain. May participate in kidney development and may be involved in podocyte differentiation.
  • Tissue specificity

    Expressed in lung, liver, kidney, heart and pancreas. Expressed in endothel of umbilical vessels.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab164688 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164688 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up