Description

  • Product name

    Recombinant Human ATOX1 protein
  • Purity

    > 95 % SDS-PAGE.
    ab116474 is purified by proprietary chromatographic techniques and filter sterilized.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPKHEFSVDMTCGGCAEAVSRVLNKLGGVK YDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
    • Predicted molecular weight

      10 kDa including tags
    • Amino acids

      1 to 68
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116474 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.02% DTT, 10% Glycerol

General Info

  • Alternative names

    • ATOX1
    • ATOX1_HUMAN
    • ATX1
    • ATX1 antioxidant protein 1 homolog
    • ATX1 antioxidant protein 1 homolog (yeast)
    • Copper transport protein
    • Copper transport protein ATOX1
    • HAH1
    • Metal transport protein
    • Metal transport protein ATX1
    • MGC138453
    • MGC138455
    see all
  • Function

    Could bind and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the ATX1 family.
    Contains 1 HMA domain.
  • Information by UniProt

References

ab116474 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116474.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up