Description

  • Product name

    Recombinant human ATP citrate lyase protein
    See all ATP citrate lyase proteins and peptides
  • Biological activity

    Specific Activity: ≥440 pmole/min/μg. 

    A 25 µl ACLY reaction is conducted in a buffer containing 40 mM Tris (pH 8.0), 10 mM MgCl2, 2 mM DTT, 2 mM potassium citrate, 0.1 mM CoA and 6-100 ng ab196090 at 30 °C for 60 min.

  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWL LSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATG FLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQ KLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYL EINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEE AYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNV AATFKGIVRAIRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGI PIHVFGTETHMTAIVGMALGHRPIPNQPPTAAHTANFLLNASGSTSTPAP SRTASFSESRADEVAPAKKAKPAMPQDSVPSPRSLQGKSTTLFSRHTKAI VWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILI PVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEG IPEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASK LYRPGSVAYVSRSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDH VLRYQDTPGVKMIVVLGEIGGTEEYKICRGIKEGRLTKPIVCWCIGTCAT MFSSEVQFGHAGACANQASETAVAKNQALKEAGVFVPRSFDELGEIIQSV YEDLVANGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQ ELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADH GPAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAF DSGIIPMEFVNKMKKEGKLIMGIGHRVKSINNPDMRVQILKDYVRQHFPA TPLLDYALEVEKITTSKKPNLILNVDGLIGVAFVDMLRNCGSFTREEADE YIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDDISYVLPEHMS M
    • Predicted molecular weight

      147 kDa including tags
    • Amino acids

      1 to 1101
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_001096.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab196090 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.018% Potassium chloride, 0.55% Glutathione, 10% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ACL
    • Acly
    • ACLY_HUMAN
    • ATP citrate (pro-S) lyase
    • ATP citrate lyase
    • ATP citrate synthase
    • ATP-citrate (pro-S-)-lyase
    • ATP-citrate synthase
    • ATPcitrate synthase
    • ATPCL
    • Citrate cleavage enzyme
    • CLATP
    • OTTHUMP00000164773
    see all
  • Function

    ATP-citrate synthase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine.
  • Sequence similarities

    In the N-terminal section; belongs to the succinate/malate CoA ligase beta subunit family.
    In the C-terminal section; belongs to the succinate/malate CoA ligase alpha subunit family.
    Contains 1 ATP-grasp domain.
  • Post-translational
    modifications

    ISGylated.
    Acetylated at Lys-540, Lys-546 and Lys-554 by KAT2B/PCAF. Acetylation is promoted by glucose and stabilizes the protein, probably by preventing ubiquitination at the same sites. Acetylation promotes de novo lipid synthesis. Deacetylated by SIRT2.
    Ubiquitinated at Lys-540, Lys-546 and Lys-554 by UBR4, leading to its degradation. Ubiquitination is probably inhibited by acetylation at same site.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of 7 µg ab196090 with Coomassie staining.

  • Enzyme activity of ab196090.

References

ab196090 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196090.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up