Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQ NLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLK NFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLL VGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEIN PLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYI ADLDAKSGASLK
    • Molecular weight
      46 kDa including tags
    • Amino acids
      4 to 265
    • Tags
      His tag N-Terminus
    • Additional sequence information
      N-terminal 6xHis-SUMO-tagged

Specifications

Our Abpromise guarantee covers the use of ab235007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names
    • ACL
    • Acly
    • ACLY_HUMAN
    • ATP citrate (pro-S) lyase
    • ATP citrate lyase
    • ATP citrate synthase
    • ATP-citrate (pro-S-)-lyase
    • ATP-citrate synthase
    • ATPcitrate synthase
    • ATPCL
    • Citrate cleavage enzyme
    • CLATP
    • OTTHUMP00000164773
    see all
  • Function
    ATP-citrate synthase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine.
  • Sequence similarities
    In the N-terminal section; belongs to the succinate/malate CoA ligase beta subunit family.
    In the C-terminal section; belongs to the succinate/malate CoA ligase alpha subunit family.
    Contains 1 ATP-grasp domain.
  • Post-translational
    modifications
    ISGylated.
    Acetylated at Lys-540, Lys-546 and Lys-554 by KAT2B/PCAF. Acetylation is promoted by glucose and stabilizes the protein, probably by preventing ubiquitination at the same sites. Acetylation promotes de novo lipid synthesis. Deacetylated by SIRT2.
    Ubiquitinated at Lys-540, Lys-546 and Lys-554 by UBR4, leading to its degradation. Ubiquitination is probably inhibited by acetylation at same site.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab235007 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235007 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up