Overview

  • Product name

    Recombinant Human ATP12A protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SSFNKMIPQQALVIRDSEKKTIPSEQLVVGDIVEVKGGDQIPADIRVLSS QGCRVDNSSLTGESEPQPRSSEFTHENPLETKNICFYSTTCLEASTSPVG TVTGMVIN
    • Amino acids

      174 to 281
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP1AL1
    • ATPase H+/K+ transporting nongastric alpha polypeptide
    • ATPase Na+K+ transporting alpha-1 polypeptide-like
    • Hydrogen/potassium-exchanging ATPase 12A
    • Non-gastric H(+)/K(+) ATPase subunit alpha
    • Potassium-transporting ATPase alpha chain 2
    • Proton pump
    • Sodium/potassium ATPase alpha polypeptide-like
    see all
  • Relevance

    ATP12A catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. Responsible for potassium absorption in various tissues.
  • Cellular localization

    Cell Membrane; Multi-pass membrane protein

Images

  • ab157924 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157924 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up