Overview

  • Product name

    Recombinant Human ATP2C1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDR VPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAF MGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQ L
    • Amino acids

      119 to 269
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162058 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1700121J11Rik
    • AT2C1_HUMAN
    • ATP dependent Ca(2+) pump PMR1
    • ATP-dependent Ca(2+) pump PMR1
    • ATP2C1
    • ATP2C1A
    • ATPase 2C1
    • ATPase Ca(2+) sequestering
    • ATPase Ca++ transporting type 2C member 1
    • AW061228
    • BCPM
    • Calcium transporting ATPase type 2C member 1
    • Calcium-transporting ATPase type 2C member 1
    • D930003G21Rik
    • HHD
    • hSPCA1
    • HUSSY 28
    • KIAA1347
    • MGC58010
    • MGC93231
    • OTTHUMP00000216066
    • OTTHUMP00000216068
    • OTTHUMP00000216069
    • OTTHUMP00000216071
    • OTTHUMP00000216072
    • OTTHUMP00000216073
    • OTTHUMP00000216074
    • OTTHUMP00000216075
    • PMR1
    • PMR1, rat, homolog of
    • PMR1L
    • Secretory pathway Ca(2+) ATPase 1
    • Secretory pathway Ca(2+)-transporting ATPase
    • Secretory pathway Ca2+/Mn2+ ATPase 1
    • SPCA
    • SPCA1
    see all
  • Function

    This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium.
  • Tissue specificity

    Found in most tissues except colon, thymus, spleen and leukocytes. Most abundant in keratinocytes and kidney.
  • Involvement in disease

    Defects in ATP2C1 are the cause of Hailey-Hailey disease (HHD) [MIM:169600]; also known as benign familial pemphigus. HHD is an autosomal dominant disorder characterized by persistent blisters and suprabasal cell separation (acantholysis) of the epidermis, due to impaired keratinocyte adhesion. Patients lacking all isoforms except isoform 2 have HHD.
  • Sequence similarities

    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab162058 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162058 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162058.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up