Overview

  • Product name

    Recombinant Human ATP5C1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKM VAAAKYARAERELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDR GLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILYRTHSDQFL VAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEE KPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQ SARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD
    • Molecular weight

      59 kDa including tags
    • Amino acids

      1 to 298

Specifications

Our Abpromise guarantee covers the use of ab152210 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl

     This product was previously labelled as ATPG

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP synthase gamma chain, mitochondrial
    • ATP synthase subunit gamma
    • ATP synthase subunit gamma, mitochondrial
    • ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1
    • ATP synthase, H+ transporting, mitochondrial F1 complex, gamma subunit
    • ATP5C
    • ATP5C 1
    • ATP5C1
    • ATP5CL1
    • ATPG_HUMAN
    • F ATPase gamma subunit
    • F-ATPase gamma subunit
    • mitochondrial
    • Mitochondrial ATP synthase, gamma subunit 1
    see all
  • Function

    Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and the central stalk which is part of the complex rotary element. The gamma subunit protrudes into the catalytic domain formed of alpha(3)beta(3). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
  • Tissue specificity

    Isoform Heart is expressed specifically in the heart and skeletal muscle, which require rapid energy supply. Isoform Liver is expressed in the brain, liver and kidney. Isoform Heart and Isoform Liver are expressed in the skin, intestine, stomach and aorta.
  • Sequence similarities

    Belongs to the ATPase gamma chain family.
  • Cellular localization

    Mitochondrion. Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152210 stained with Coomassie Blue.

References

ab152210 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152210.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up