Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQN GVSQLIQREFQTSAI
    • Amino acids
      1 to 65
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157937 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AT5G3_HUMAN
    • ATP synthase H+ transporting mitochondrial Fo complex subunit C3 (subunit 9)
    • ATP synthase lipid binding protein mitochondrial
    • ATP synthase lipid-binding protein
    • ATP synthase mitochondrial C subunit 3
    • ATP synthase proteolipid P3
    • ATP synthase subunit 9
    • ATP5G3
    • ATPase protein 9
    • ATPase subunit c
    • mitochondrial
    • P3
    see all
  • Function
    Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.
  • Sequence similarities
    Belongs to the ATPase C chain family.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt

Images

  • ab157937 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157937 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157937.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up