Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMAAMATARVRMGPRCAQALWRMPWLPVFLSLAAAAAAAAAEQQVPLVLW SSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIE DFTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQE KLGASPLHVDLATLRELKLNASLPALLLIRLPYTASSGLMAPREVLTGND EVIGQVLSTLKSEDVPYTAALTAVRPSRVARDVAVVAGGLGRQLLQKQPV SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS FWNDSFARLSLTYERLFGTTVTFKFILANRLYPVSARHWFTMERLEVHSN GSVAYFNASQVTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDF QIQAFNVMGEQFSYASDCASFFSPGIWMGLLTSLFMLFIFTYGLHMILSL KTMDRFDDHKGPTISLTQIV
    • Amino acids
      1 to 470
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 16A
    • Ac45
    • ATP6IP1
    • ATP6S1
    • ATPase H+ transporting lysosomal (vacuolar proton pump) subunit 1
    • ATPase H+ transporting lysosomal accessory protein 1
    • ATPase H+ transporting lysosomal interacting protein 1
    • CF2
    • H ATPase subunit
    • MGC129781
    • ORF
    • Protein XAP 3
    • Protein XAP3
    • V ATPase Ac45 subunit
    • V ATPase S1 accessory protein
    • V ATPase subunit S1
    • V type proton ATPase subunit S1
    • Vacuolar ATP synthase subunit S1
    • Vacuolar proton pump subunit S1
    • VATPS1
    • XAP 3
    • XAP3
    see all
  • Relevance
    ATP6AP1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme, which is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. V-ATPase dependent organelle acidification is necessary for intracellular processes such as receptor-mediated endocytosis, protein sorting and zymogen activation.
  • Cellular localization
    Vacuole membrane. Single-pass membrane protein.

Images

  • ab157947 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up