Name: Recombinant Human ATP6V0A1 protein
SKU: ab157946

Product name

Recombinant Human ATP6V0A1 protein
Protein length

Protein fragment

Nature

Recombinant
Source

Wheat germ
Amino Acid Sequence
- Species
  
  Human
- Sequence
  
  GDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGV NTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVR
- Amino acids
  
  212 to 298
- Tags
  
  GST tag N-Terminus

Our Abpromise guarantee covers the use of ab157946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Applications

ELISA

Western blot
Form

Liquid
Additional notes

Protein concentration is above or equal to 0.05 mg/ml.
Concentration information loading...

Stability and Storage

Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl

Alternative names
- a1
- ATP6N1
- ATP6N1A
- ATP6V0A1
- ATPase H+ transporting lysosomal (vacuolar proton pump) non catalytic accessory protein 1A (110/116kD)
- ATPase H+ transporting lysosomal non catalytic accessory protein 1 (110/116kD)
- ATPase H+ transporting lysosomal V0 subunit a1
- ATPase H+ transporting V0 subunit a1
- ATPase, H+ transporting, lysosomal, noncatalytic accessory protein 1A
- Clathrin coated vesicle/synaptic vesicle proton pump 116 kDa subunit
- Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit
- DKFZp781J1951
- H(+) transporting two sector ATPase 116 kDa accessory protein A1
- Stv1
- V ATPase 116 kDa
- V ATPase 116 kDa isoform a1
- V type proton ATPase 116 kDa subunit a
- V type proton ATPase 116 kDa subunit a isoform 1
- V-ATPase 116 kDa isoform a1
- V-type proton ATPase 116 kDa subunit a isoform 1
- Vacuolar adenosine triphosphatase subunit Ac116
- Vacuolar proton pump subunit 1
- Vacuolar proton pump, subunit 1
- Vacuolar proton translocating ATPase 116 kDa subunit A
- Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
- Vacuolar type H(+) ATPase 115 kDa subunit
- Vph1
- VPP1
- VPP1_HUMAN
see all
Function

Required for assembly and activity of the vacuolar ATPase. Potential role in differential targeting and regulation of the enzyme for a specific organelle.
Sequence similarities

Belongs to the V-ATPase 116 kDa subunit family.
Cellular localization

Cytoplasmic vesicle membrane. Melanosome. Coated vesicle. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Target information above from: UniProt accession Q93050 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt

SDS-PAGE - Recombinant Human ATP6V0A1 protein (ab157946)

ab157946 on a 12.5% SDS-PAGE stained with Coomassie Blue.

Datasheet

ab157946 has not yet been referenced specifically in any publications.

Publishing research using ab157946? Please let us know so that we can cite the reference in this datasheet.

Location selector

Your location is currently set to:

Custom solutions & partnerships

Overview

Description

Specifications

Preparation and Storage

General Info

Images

Datasheets and documents

References

Customer reviews and Q&As