Recombinant Human ATP6V0A1 protein (ab157946)

Overview

  • Product name
    Recombinant Human ATP6V0A1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMASGV NTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVR
    • Amino acids
      212 to 298
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • a1
    • ATP6N1
    • ATP6N1A
    • ATP6V0A1
    • ATPase H+ transporting lysosomal (vacuolar proton pump) non catalytic accessory protein 1A (110/116kD)
    • ATPase H+ transporting lysosomal non catalytic accessory protein 1 (110/116kD)
    • ATPase H+ transporting lysosomal V0 subunit a1
    • ATPase H+ transporting V0 subunit a1
    • ATPase, H+ transporting, lysosomal, noncatalytic accessory protein 1A
    • Clathrin coated vesicle/synaptic vesicle proton pump 116 kDa subunit
    • Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit
    • DKFZp781J1951
    • H(+) transporting two sector ATPase 116 kDa accessory protein A1
    • Stv1
    • V ATPase 116 kDa
    • V ATPase 116 kDa isoform a1
    • V type proton ATPase 116 kDa subunit a
    • V type proton ATPase 116 kDa subunit a isoform 1
    • V-ATPase 116 kDa isoform a1
    • V-type proton ATPase 116 kDa subunit a isoform 1
    • Vacuolar adenosine triphosphatase subunit Ac116
    • Vacuolar proton pump subunit 1
    • Vacuolar proton pump, subunit 1
    • Vacuolar proton translocating ATPase 116 kDa subunit A
    • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1
    • Vacuolar type H(+) ATPase 115 kDa subunit
    • Vph1
    • VPP1
    • VPP1_HUMAN
    see all
  • Function
    Required for assembly and activity of the vacuolar ATPase. Potential role in differential targeting and regulation of the enzyme for a specific organelle.
  • Sequence similarities
    Belongs to the V-ATPase 116 kDa subunit family.
  • Cellular localization
    Cytoplasmic vesicle membrane. Melanosome. Coated vesicle. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • ab157946 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up