Overview

  • Product name

    Recombinant Human ATP6V0C protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPE QIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVG LSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAL ILSTK
    • Amino acids

      1 to 155
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP6C
    • ATP6L
    • ATPase, H+ transporting, lysosomal, V0 subunit c
    • ATPL
    • V ATPase subunit c
    • Vacuolar ATP synthase 16 kDa proteolipid subunit
    • Vacuolar H+ ATPase proton channel subunit
    • Vacuolar proton pump, 16 kDa subunit
    • VATL
    • Vma3
    see all
  • Relevance

    ATP6V0C is a component of the V0 domain (proton pore complex) of vacuolar ATPase (V-ATPase). Vacuolar ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation.
  • Cellular localization

    Vacuole membrane; Multi-pass membrane protein.

Images

  • ab157941 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157941 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up