Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGD KTLEDRFFEHEVKLNKLAFLN
    • Amino acids
      238 to 308
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab160343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 32 kDa accessory protein
    • ATP6D
    • ATP6DV
    • ATP6V0D1
    • ATPase H+ transporting lysosomal (vacuolar proton pump) member D
    • ATPase H+ transporting lysosomal 38kD V0 subunit d
    • ATPase H+ transporting lysosomal 38kDa V0 subunit d1
    • ATPase H+ transporting lysosomal V0 subunit d1
    • H(+) transporting two sector ATPase subunit D
    • p39
    • V ATPase 40 KDa accessory protein
    • V ATPase AC39 subunit
    • V ATPase subunit D
    • V ATPase subunit d 1
    • V-ATPase 40 kDa accessory protein
    • V-ATPase AC39 subunit
    • V-ATPase subunit d 1
    • V-type proton ATPase subunit d 1
    • VA0D1_HUMAN
    • Vacuolar ATP synthase subunit d 1
    • Vacuolar proton pump subunit d 1
    • VATX
    • VMA 6
    • VMA6
    • VPATPD
    see all
  • Function
    Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis (By similarity). May play a role in cilium biogenesis through regulation of the transport and the localization of proteins to the cilium.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the V-ATPase V0D/AC39 subunit family.
  • Cellular localization
    Membrane. Localizes to centrosome and the base of the cilium.
  • Information by UniProt

Images

  • ab160343 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160343 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up