Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQR LKIMEYYEKKEKQIEQQKKILMSTMRNQARLKVLRARNDLISDLLSEAKL RLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQK AIPEYMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKVSNTLESRL DLSAKQKMPEIRMALFGANTNRKFFI
    • Amino acids
      1 to 226
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP6V1E2
    • ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2
    • V-ATPase subunit E 2
    • V-type proton ATPase subunit e 2
    • Vacuolar proton pump subunit e 2
    • vacuolar type proton-translocating ATPase subunit E1
    • VATE2_HUMAN
    see all
  • Function
    Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.
  • Tissue specificity
    Testis specific.
  • Sequence similarities
    Belongs to the V-ATPase E subunit family.
  • Information by UniProt

Images

  • ab164825 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164825 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up