Description

  • Product name

    Recombinant Human ATPAF1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAE AQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAE LKCAQNQNKT
    • Amino acids

      219 to 328
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP synthase mitochondrial F1 complex assembly factor 1
    • ATP11
    • ATP11 homolog
    • ATP11p
    • ATPAF 1
    • atpaf1
    • ATPF1_HUMAN
    • FLJ22351
    • Homolog of yeast ATP11
    • MGC88060
    see all
  • Function

    May play an essential role for the assembly of the mitochondrial F1-F0 complex.
  • Tissue specificity

    Weakly expressed in muscle.
  • Sequence similarities

    Belongs to the ATP11 family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • ab163868 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up