Description

  • Product name

    Recombinant Human ATR protein
  • Purity

    > 85 % SDS-PAGE.
    assessed by densitometry
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANHASHEPFPGHWAYIA GFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLMEFNSL INKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLY KEKGVYMTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTF PDPTSWYSSRSAYCRSTAVMSMVGYILGLGDRHGENILFDSLTGECVHVD FNCLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTMRLMR DQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNETGEVVNEKAKTHVLD IEQRLQGVIK TRNRVT
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      2245 to 2610
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

General Info

  • Alternative names

    • Ataxia telangiectasia and Rad3 related
    • Ataxia telangiectasia and Rad3-related protein
    • ATR
    • ATR_HUMAN
    • FCTCS
    • FRAP Related Protein 1
    • FRAP-related protein 1
    • FRP1
    • MEC1
    • MEC1 mitosis entry checkpoint 1 homolog
    • Protein kinase ATR
    • RAC3
    • Rad3 related protein
    • SCKL
    • SCKL1
    • Serine/threonine protein kinase ATR
    • Serine/threonine-protein kinase ATR
    see all
  • Function

    Serine/threonine protein kinase which activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR), ultraviolet light (UV), or DNA replication stalling, thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates BRCA1, CHEK1, MCM2, RAD17, RPA2, SMC1 and p53/TP53, which collectively inhibit DNA replication and mitosis and promote DNA repair, recombination and apoptosis. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX at sites of DNA damage, thereby regulating DNA damage response mechanism. Required for FANCD2 ubiquitination. Critical for maintenance of fragile site stability and efficient regulation of centrosome duplication.
  • Tissue specificity

    Ubiquitous, with highest expression in testis. Isoform 2 is found in pancreas, placenta and liver but not in heart, testis and ovary.
  • Involvement in disease

    Defects in ATR are a cause of Seckel syndrome type 1 (SCKL1) [MIM:210600]. SCKL1 is a rare autosomal recessive disorder characterized by growth retardation, microcephaly with mental retardation, and a characteristic 'bird-headed' facial appearance.
  • Sequence similarities

    Belongs to the PI3/PI4-kinase family. ATM subfamily.
    Contains 1 FAT domain.
    Contains 1 FATC domain.
    Contains 2 HEAT repeats.
    Contains 1 PI3K/PI4K domain.
  • Post-translational
    modifications

    Phosphorylated; autophosphorylates in vitro.
  • Cellular localization

    Nucleus. Nucleus > PML body. Depending on the cell type, it can also be found in PML nuclear bodies. Recruited to chromatin during S-phase. Redistributes to discrete nuclear foci upon DNA damage, hypoxia or replication fork stalling.
  • Information by UniProt

Images

  • SDS-PAGE showing ab204140.

References

ab204140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up