Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGR RGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPVEDDSDAETYG EENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSAGD SFSQFRFAEEKEWDSEASCPKQNSAFYVDSELLVRALQELPLCLRLNVAA ELVQGTVPLEVPQVKPKRTDDGKGLGMQLKGPLGPGGRGPIFELKSVAAG CPVLLGKDNPSPGPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGD NILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSKNVTE EELEDWLDSMIS
    • Amino acids
      1 to 362
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1700013A01Rik
    • 1700056A21Rik
    • Apoptosis caspase activation inhibitor
    • AVEN
    • AVEN_HUMAN
    • Cell death regulator Aven
    • mAven L
    • mAven S
    • MGC124011
    • OTTMUSP00000016129
    • PDCD12
    • Programmed cell death 12
    • RP23-52C15.2
    see all
  • Function
    Protects against apoptosis mediated by Apaf-1.
  • Tissue specificity
    Highly expressed in testis, ovary, thymus, prostate, spleen, small intestine, colon, heart, skeletal muscle, liver, kidney and pancreas.
  • Cellular localization
    Endomembrane system. Associated with intracellular membranes.
  • Information by UniProt

Images

  • ab163479 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up