Description

  • Product name

    Recombinant Human Axin 2 protein
    See all Axin 2 proteins and peptides
  • Purity

    > 70 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSSAMLVTCLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMS VSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLE REKCVDTLDFWFACNGFRQMNLKDTKTLRVAKAIYKRYIENNSIVSKQLK PATKTYIRDGIKKQQIDSIMFDQAQTEIQSVMEENAYQMFLTSDIYLEYV RSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFKCKLSPTVVGL SSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHIGSGYVFAPATSANDS EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLP HFPRTHRLPKEMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIRE DEEREGSELTLNSREGAPTQHPLSLLPSGSYEEDPQTILDDHLSRVLKTP GCQSPGVGRYSPRSRSPDHHHHHHSQYHSLLPPGGKLPPAAASPGACPLL GGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVHCFCPGGSEYY CYSKCKSHSKAPETMPSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESAR SSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEA CRRLAEVSKPPKQRCCVASQQRDRNHSATVQTGATPFSNPSLAPEDHKEP KKLAGVHALQASELVVTYFFCGEEIPYRRMLKAQSLTLGHFKEQLSKKGN YRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVERID
    • Predicted molecular weight

      130 kDa including tags
    • Amino acids

      1 to 843
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204097 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.31% Glutathione, 25% Glycerol, 0.29% Sodium chloride, 0.79% Tris HCl, 0.003% EDTA, 0.004% DTT, 0.002% PMSF

General Info

  • Alternative names

    • Axil
    • Axin like protein
    • Axin-2
    • Axin-like protein
    • Axin2
    • AXIN2_HUMAN
    • Axis inhibition protein 2
    • Conductin
    • DKFZp781B0869
    • MGC10366
    • MGC126582
    see all
  • Function

    Inhibitor of the Wnt signaling pathway. Down-regulates beta-catenin. Probably facilitate the phosphorylation of beta-catenin and APC by GSK3B.
  • Tissue specificity

    Expressed in brain and lymphoblast.
  • Involvement in disease

    Defects in AXIN2 are involved in colorectal cancer (CRC) [MIM:114500]. They appear to be specifically associated with defective mismatch repair.
    Defects in AXIN2 are the cause of oligodontia-colorectal cancer syndrome (ODCRCS) [MIM:608615]. Affected individuals manifest severe tooth agenesis and colorectal cancer or precancerous lesions of variable types.
  • Sequence similarities

    Contains 1 DIX domain.
    Contains 1 RGS domain.
  • Domain

    The tankyrase-binding motif (also named TBD) is required for interaction with tankyrase TNKS and TNKS2.
  • Post-translational
    modifications

    Probably phosphorylated by GSK3B and dephosphorylated by PP2A.
    ADP-ribosylated by tankyrase TNKS and TNKS2. Poly-ADP-ribosylated protein is recognized by RNF146, followed by ubiquitination and subsequent activation of the Wnt signaling pathway.
    Ubiquitinated by RNF146 when poly-ADP-ribosylated, leading to its degradation and subsequent activation of the Wnt signaling pathway. Deubiquitinated by USP34, deubiquitinated downstream of beta-catenin stabilization step: deubiquitination is important Wnt signaling to positively regulate beta-catenin (CTNBB1)-mediated transcription.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE showing ab204097

References

ab204097 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204097.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up