Description

  • Product name

    Recombinant human Axl protein
    See all Axl proteins and peptides
  • Biological activity

    The specific activity of ab167950 was determined to be 3 nmol/min/mg.
  • Purity

    > 85 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HRRKKETRYGEVFEPTVERGELVVRYCVRKSYSRRTTEATLNSLGISEEL KEKLRDVMVD RHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMK IAICTRSELEDFLSEAVCMKEF DHPNVMRLIGVCFQGSERESFPAPVV ILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKF MADIASGMEYLSTK RFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMP VK WIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQ GNRLKQPA DCLDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPP AQEPDEILYVNMDEGGGYPE PPGAAGGADPPTQPDPKDSCSCLTAAEV HPAGRYVLCPSTTPSPAQPADRGSPAAPGQED GA
    • Predicted molecular weight

      76 kDa including tags
    • Amino acids

      473 to 894
    • Tags

      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab167950 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Adhesion related kinase
    • AI323647
    • Ark
    • Axl
    • AXL oncogene
    • AXL receptor tyrosine kinase
    • AXL transforming gene
    • AXL transforming sequence/gene
    • EC 2.7.10.1
    • JTK11
    • Oncogene AXL
    • Tyro7
    • Tyrosine protein kinase receptor UFO
    • Tyrosine-protein kinase receptor UFO
    • UFO
    • UFO_HUMAN
    see all
  • Function

    May function as a signal transducer between specific cell types of mesodermal origin. In case of filovirus infection, seems to function as a cell entry factor.
  • Tissue specificity

    Highly expressed in metastatic colon tumors. Expressed in primary colon tumors. Weakly expressed in normal colon tissue.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. AXL/UFO subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • The specific activity of Axl (ab167950) was determined to be 3.5 nmol/min/mg as per activity assay protocol
  • SDS PAGE analysis of ab167950
  • SDS PAGE analysis of ab167950
  • The specific activity of ab167950 was determined to be 3 nmol/min/mg.
  • SDS Page analysis of ab167950

References

ab167950 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167950.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up