Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV EWLGWLNTIQ
    • Molecular weight

      32 kDa including tags
    • Amino acids

      1 to 60

Specifications

Our Abpromise guarantee covers the use of ab152230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • B2
    • B2 bradykinin receptor
    • B2BKR
    • B2BRA
    • B2R
    • BDKR B2
    • BDKRB 2
    • BDKRB2
    • BK 2
    • BK 2 receptor
    • BK R2
    • BK-2 receptor
    • BK2
    • BK2 receptor
    • BK2R
    • BKR 2
    • BKR2
    • BKRB2_HUMAN
    • BR B2
    • Bradykinin receptor B2
    • Bradykinin receptor beta 2
    • BRB 2
    • BRB2
    • DKFZp686O088
    • Kinin B2
    see all
  • Function

    Receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
  • Tissue specificity

    Ubiquitous. Widespread in normal smooth muscle tissue and neurons.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Bradikinin receptor subfamily. BDKRB2 sub-subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152230 stained with Coomassie Blue.

References

ab152230 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up