Recombinant Human B3GALT2 protein (ab160151)

Description

  • Product name

    Recombinant Human B3GALT2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLQWRRRHCCFAKMTWNAKRSLFRTHLIGVLSLVFLFAMFLFFNHHDWLP GRAGFKENPVTYTFRGFRSTKSETNHSSLRNIWKETVPQTLRPQTATNSN NTDLSPQGVTGLENTLSANGSIYNEKGTGHPNSYHFKYIINEPEKCQEKS PFLILLIAAEPGQIEARRAIRQTWGNESLAPGIQITRIFLLGLSIKLNGY LQRAILEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWVATYCPHIPYVMK TDSDMFVNTEYLINKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPP DLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAK LRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQN KHNACANAAKEKAGRYRHRKLH
    • Amino acids

      1 to 422
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3-galactosyltransferase 2
    • 3-GalTase 2
    • B3GALT2
    • B3GT2_HUMAN
    • beta 1 3 galactosyltransferase 2
    • beta 1 3 GalTase 2
    • beta 3 galt2
    • Beta-1
    • beta3Gal T2
    • Beta3Gal-T2
    • Beta3GalT2
    • GLCT2
    • UDP Gal betaGlcNAc beta 1 3 galactosyltransferase polypeptide 2
    • UDP galactose 2 acetamido 2 deoxy D glucose 3beta galactosyltransferase 2
    • UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2
    • UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase 2
    see all
  • Function

    Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. Can also utilize substrates with a terminal galactose residue, albeit with lower efficiency. Involved in the biosynthesis of the carbohydrate moieties of glycolipids and glycoproteins. Inactive towards substrates with terminal alpha-N-acetylglucosamine (alpha-GlcNAc) or alpha-N-acetylgalactosamine (alpha-GalNAc) residues.
  • Tissue specificity

    Detected in heart and brain.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 31 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160151 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up