Recombinant Human B3GALT5 protein (ab160944)

Description

  • Product name

    Recombinant Human B3GALT5 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQ TWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVY
    • Amino acids

      29 to 128
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3-galactosyltransferase 5
    • 3-GalTase 5
    • b3Gal-T5
    • B3GalT-V
    • B3GALT5
    • B3GalTx
    • B3GT5_HUMAN
    • B3T5
    • Beta-1
    • Beta-1,3-Gal Tase 5
    • Beta-1,3-galactosyltransferase 5
    • beta-1,3-GalTase 5
    • beta-3-galactosyltransferase 5
    • Beta-3-Gx-T5
    • Beta3Gal-T5
    • Beta3GalT5
    • GLCT5
    • Homolog of C. elegans Bt toxin resistance gene bre-5
    • UDP-Gal:beta-GlcNAc beta-1
    • UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5
    • UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
    • UDP-galactose:beta-N-acetylglucosamine beta-1
    • UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5
    see all
  • Function

    Catalyzes the transfer of Gal to GlcNAc-based acceptors with a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Can use glycolipid LC3Cer as an efficient acceptor.
  • Tissue specificity

    Expressed in stomach, jejunum, colon, pancreas, small intestine, testis and gastrointestinal and pancreatic cancer cell lines. Hardly detected in lung, liver, adrenal gland and peripheral blood leukocytes.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 31 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160944 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up