Description

  • Product name

    Recombinant Human B3GALT6 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVT HKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGI P
    • Amino acids

      229 to 329
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Beta 1 3 galactosyltransferase 6
    • Beta 3GalT6
    • Beta3GalT6
    • GAG GalTII
    • Galactosyltransferase II
    • Galactosylxylosylprotein 3 beta galactosyltransferase
    • UDP Gal:betaGal beta 1 3 galactosyltransferase polypeptide 6
    • UDP Gal:betaGlcNAc beta 1 3 galactosyltransferase polypeptide 6
    see all
  • Relevance

    B3GALT6 is a beta-1,3-galactosyltransferase which belongs to the glycosyltransferase 31 family. It transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has no activity towards substrates with terminal galactosamine or glucosamine residues.
  • Cellular localization

    Golgi apparatus. Golgi stack membrane; Single pass type II membrane protein.

Images

  • ab165262 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up