Description

  • Product name

    Recombinant Human B3GALTL protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRPPACWWLLAPPALLALLTCSLAFGLASEDTKKEVKQSQDLEKSGISRK NDIDLKGIVFVIQSQSNSFHAKRAEQLKKSILKQAADLTQELPSVLLLHQ LAKQEGAWTILPLLPHFSVTYSRNSSWIFFCEEETRIQIPKLLETLRRYD PSKEWFLGKALHDEEATIIHHYAFSENPTVFKYPDFAAGWALSIPLVNKL TKRLKSESLKSDFTIDLKHEIALYIWDKGGGPPLTPVPEFCTNDVDFYCA TTFHSFLPLCRKPVKKKDIFVAVKTCKKFHGDRIPIVKQTWESQASLIEY YSDYTENSIPTVDLGIPNTDRGHCGKTFAILERFLNRSQDKTAWLVIVDD DTLISISRLQHLLSCYDSGKPVFLGERYGYGLGTGGYSYITGGGGMVFSR EAVRRLLASKCRCYSNDAPDDMVLGMCFSGLGIPVTHSPLFHQARPVDYP KDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREEL
    • Amino acids

      1 to 498
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • B3GlcT
    • B3GTL
    • Beta 1,3 galactosyltransferase like
    • Beta 3 galactosyltransferase like
    • Beta-1,3-glucosyltransferase
    • Beta-3-glycosyltransferase-like
    • Beta3Glc-T
    • Beta3GlcT
    • Galactosyltransferase
    • GalT
    see all
  • Relevance

    B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin (see THBS1; MIM 188060) type-1 repeats (TSRs) of many biologically important proteins. Biosynthesis of glucosyl-beta-1,3-fucose-O- is initiated by protein O-fucosyltransferase-2 (POFUT2; MIM 610249), which attaches the fucosyl residue to a serine or threonine within the TSR. B3GALTL subsequently transfers the glucose onto TSR-fucose (Hess et al., 2008).
  • Cellular localization

    Endoplasmic reticulum membrane; Single pass type II membrane protein.

Images

  • ab165517 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up