Description

  • Product name

    Recombinant Human B3GNT4 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GGYVMSRATVRRLQAIMEDAELFPIDDVFVGMCLRRLGLSPMHHAGFKTF GIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMWALVTDEGLKCAAGPIPQR
    • Amino acids

      279 to 378
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • B3GN T4
    • Beta 1,3 Gn T4
    • Beta 1,3 N acetylglucosaminyltransferase 4
    • Beta 1,3 N acetylglucosaminyltransferase bGn T4
    • Beta3Gn T4
    • BGnT4
    • EC 2.4.1.-
    • UDP GlcNAc:betaGal beta 1,3 N acetylglucosaminyltransferase 4
    see all
  • Relevance

    B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate.
  • Cellular localization

    Golgi Apparatus membrane; Single-pass type II membrane protein

Images

  • ab164023 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up