Description

  • Product name

    Recombinant Human B3GNT5 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRMLVSGRRVKKWQLIIQLFATCFLASLMFFWEPIDNHIVSHMKSYSYRY LINSYDFVNDTLSLKHTSAGPRYQYLINHKEKCQAQDVLLLLFVKTAPEN YDRRSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGEELQRKLAWED QRYNDIIQQDFVDSFYNLTLKLLMQFSWANTYCPHAKFLMTADDDIFIHM PNLIEYLQSLEQIGVQDFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPAYP DYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQDH VFFSGEGKTPYHPCIYEKMMTSHGHLEDLQDLWKNATDPKVKTISKGFFG QIYCRLMKIILLCKISYVDTYPCRAAFI
    • Amino acids

      1 to 378
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • B3GN-T5
    • B3GNT5
    • Beta 1,3 N acetyglucosaminyltransferase Lc3 synthase
    • Beta 1,3 N acetylglucosaminyltransferase 5
    • Beta 1,3-N acetylglucosaminyltransferase bGnT5
    • Beta-1,3-Gn-T5
    • Beta3Gn T5
    • Beta3Gn-T5
    • beta3GnT5
    • BGnT-5
    • EC 2.4.1.-
    • Lactotriaosylceramide synthase
    • Lc(3)Cer synthase
    • Lc3 synthase
    • UDP GlcNAc:betaGal beta 1,3 N acetylglucosaminyltransferase 5
    see all
  • Relevance

    B3GNT5 is a beta 1,3 N acetylglucosaminyltransferase that plays a key role in the synthesis of lacto- or neolacto-series carbohydrate chains on glycolipids, notably by participating in biosynthesis of HNK-1 and Lewis X carbohydrate structures. It has strong activity toward lactosylceramide (LacCer) and neolactotetraosylceramide (nLc(4)Cer; paragloboside), resulting in the synthesis of Lc(3)Cer and neolactopentaosylceramide (nLc(5)Cer), respectively.
  • Cellular localization

    Golgi Apparatus membrane; Single-pass type II membrane protein

Images

  • ab164479 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up