Overview

  • Product name

    Recombinant Human b4Gal-T6 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARG IMLRENVKTIGHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENF TYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLDIEPGGHWRPK DCKPRWKTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNY YGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWG WGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLR YSKERQYIDGLNNLIYRPKILVDRLYTNISVNLMPELAPIEDY
    • Amino acids

      1 to 343
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Beta-1, 4-galactosyltransferase 6.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4-galactosyltransferase
    • 4-galactosyltransferase 6
    • 4-GalTase 6
    • AA536803
    • AU022389
    • b4Gal-T6
    • B4galt6
    • B4GT6_HUMAN
    • Beta-1
    • beta-1,4-galactosyltransferase 6
    • beta-1,4-GalTase 6
    • Beta4Gal-T6
    • beta4GalT-VI
    • LacCer synthase
    • Lactosylceramide synthase
    • UDP-Gal:beta-GlcNAc beta-1
    • UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 6
    • UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
    • UDP-Gal:glucosylceramide beta-1
    • UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase
    • UDP-galactose:beta-N-acetylglucosamine beta-1
    • UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 6
    see all
  • Function

    Required for the biosynthesis of glycosphingolipids.
  • Tissue specificity

    High expression in brain and adrenal gland, lower in liver, lung, colon and peripheral white blood cells.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 7 family.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Trans cisternae of Golgi stack.
  • Information by UniProt

Images

  • ab160434 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up