Recombinant Human B4GALNT1 protein (ab158491)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      APGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNN CSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLS
    • Amino acids
      30 to 127
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158491 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • (N acetylneuraminyl) galactosylglucosylceramide
    • (N-acetylneuraminyl)-galactosylglucosylceramide
    • 4 N-acetylgalactosaminyltransferase 1
    • 4933429D13Rik
    • B4GALNT1
    • B4GN1_HUMAN
    • Beta 1 4 N acetyl galactosaminyl transferase 1
    • Beta 1 4 N acetylgalactosaminyltransferase 1
    • Beta-1
    • BETA-1,4-N-ACETYLGALACTOSAMINYLTRANSFERASE
    • BETA-1,4-N-ACETYLGALACTOSAMINYLTRANSFERASE 1
    • Beta1 4GalNAc T
    • Gal-NAc-T
    • GALGT
    • Galgt1
    • GalNAc T
    • GalNAc-T
    • GALNACT
    • GD2 synthase
    • Ggm-2
    • Ggm2
    • GM2 synthase
    • GM2/GD2 synthase
    • SIAT 2
    • SIAT2
    • UDP Gal:betaGlcNAc beta 1 4 N acetylgalactosaminyltransferase transferase 1
    • UDP N acetyl alpha D galactosamine:(N acetylneuraminyl) galactosylglucosylceramide N acetylgalactosaminyltransferase
    see all
  • Information by UniProt

Images

  • ab158491 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158491 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158491.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up