Description

  • Product name

    Recombinant Human B4GALT3 protein
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RSLSALFGRDQGPTFDYSHPRDVYSNLSHLPGAPGGPPAPQGLPYCPERS PLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCEPRSRTAIIVPH RAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVRE ALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYP QYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPT SVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLAREL GPLYTNITADIGTDPRGPRAPSGPRYPPGSSQAFRQEMLQRRPPARPGPL STANHTALRGSHVDHHHHHH
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      32 to 393
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Lumenal domain.

Specifications

Our Abpromise guarantee covers the use of ab191960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.32% Tris HCl, 0.87% Sodium chloride, 0.02% Magnesium chloride, 10% Glycerol

General Info

  • Alternative names

    • 4-galactosyltransferase
    • 4-galactosyltransferase 3
    • 4-GalTase 3
    • b4Gal T3
    • b4Gal-T3
    • B4GALT3
    • B4GT3_HUMAN
    • Beta 1,4 galactosyltransferase 3
    • Beta 1,4 GalTase 3
    • Beta-1
    • Beta-N-acetylglucosaminyl-glycolipid beta-1
    • Beta4Gal T3
    • Beta4Gal-T3
    • Nal synthase
    • UDP Gal:beta GlcNAc beta-1,4 galactosyltransferase 3
    • UDP-Gal:beta-GlcNAc beta-1
    • UDP-galactose:beta-N-acetylglucosamine beta-1
    see all
  • Function

    Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.
  • Tissue specificity

    Found in various tissues. Highest expression in placenta, prostate, testis, ovary, intestine and muscle, and in fetal brain.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 7 family.
  • Cellular localization

    Golgi apparatus > Golgi stack membrane. Trans cisternae of Golgi stack.
  • Information by UniProt

References

ab191960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up