Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDK EVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEV VVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAIN ITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGT VYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS
    • Molecular weight

      80 kDa including tags
    • Amino acids

      25 to 262
    • Additional sequence information

      Fused to the N-terminus of the Fc region of mouse IgG2a. NCBI Accession No. NP_001189368.1.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab215479 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 5.000 Eu/mg
  • Purity

    > 98 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    0.2 µm-filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • B7 homolog 6
    • B7-H6
    • B7H6
    • B7H6_HUMAN
    • DKFZp686O24166
    • Natural cytotoxicity triggering receptor 3 ligand 1
    • NCR3LG1
    • Putative Ig like domain containing protein DKFZp686O24166/DKFZp686I21167
    see all
  • Function

    Triggers NCR3-dependent natural killer cell activation.
  • Tissue specificity

    Not detected in any normal tissue tested. Expressed at the surface of several tumor cell lines including T and B lymphomas, myeloid leukemias, melanomas, carcinomas and large T SV40 antigen-transformed cells (at protein level).
  • Sequence similarities

    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    The C-terminal part is similar to retroviral Gag protein. This putative protein seems to be the result of a fusion between an Ig-like domain-containing protein and a ERV.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215479 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215479.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up