Description

  • Product name

    Recombinant Human B7-H6 protein (His tag)
    See all B7-H6 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDK EVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEV VVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAIN ITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGT VYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSHHHHHH
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      25 to 262
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab215607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names

    • B7 homolog 6
    • B7-H6
    • B7H6
    • B7H6_HUMAN
    • DKFZp686O24166
    • Natural cytotoxicity triggering receptor 3 ligand 1
    • NCR3LG1
    • Putative Ig like domain containing protein DKFZp686O24166/DKFZp686I21167
    see all
  • Function

    Triggers NCR3-dependent natural killer cell activation.
  • Tissue specificity

    Not detected in any normal tissue tested. Expressed at the surface of several tumor cell lines including T and B lymphomas, myeloid leukemias, melanomas, carcinomas and large T SV40 antigen-transformed cells (at protein level).
  • Sequence similarities

    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    The C-terminal part is similar to retroviral Gag protein. This putative protein seems to be the result of a fusion between an Ig-like domain-containing protein and a ERV.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up