Recombinant human B7H4 protein (ab191634)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human B7H4 protein
See all B7H4 proteins and peptides -
Biological activity
Measured by its ability to inhibit anti-CD3 antibody induced IL2 secretion in Human T lymphocytes.
The ED50 for this effect is typically 0.75 - 3 µg/ml. -
Purity
> 90 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLG LVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTY KCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPT VVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIE NDIAKATGDIKVTESEIKRRSHLQLLNSKA -
Predicted molecular weight
26 kDa including tags -
Amino acids
29 to 258 -
Tags
His tag C-Terminus -
Additional sequence information
NP_078902.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab191634 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
pH: 7.40
Constituents: 5% Trehalose, 95% PBSThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 700 µg/ml.
General Info
-
Alternative names
- B7 family member, H4
- B7 H4
- B7 homolog 4
see all -
Function
Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation. -
Tissue specificity
Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, including in kidney, liver, lung, ovary, placenta, spleen and testis. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 2 Ig-like V-type (immunoglobulin-like) domains. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Cell membrane. Expressed at the cell surface. A soluble form has also been detected. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab191634 has not yet been referenced specifically in any publications.