Description

  • Product name

    Recombinant human B7H4 protein
    See all B7H4 proteins and peptides
  • Biological activity

    Measured by the ablility to inhibit anti-CD3-induced proliferation of stimulated human T cells.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    >=5.000 Eu/mg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLG LVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTY KCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPT VVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIE NDIAKATGDIKVTESEIKRRSHLQLLNSKA
    • Predicted molecular weight

      85 kDa including tags
    • Amino acids

      29 to 258
    • Additional sequence information

      Extracellular domain fused to the N terminus of the Fc region of rabbit IgG (NP_078902.2).

Specifications

Our Abpromise guarantee covers the use of ab215003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilized from 0.2 µm-filtered solution

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • B7 family member, H4
    • B7 H4
    • B7 homolog 4
    • B7 superfamily member 1
    • B7 superfamily, member 1
    • B7-H4
    • B7h.5
    • B7h4
    • B7S1
    • B7x
    • BC032925
    • Immune costimulatory protein B7-H4
    • Immune costimulatory protein B7H4
    • MGC41287
    • PRO1291
    • Protein B7S1
    • RP11 229A19.4
    • T cell costimulatory molecule B7x
    • T-cell costimulatory molecule B7x
    • V set domain-containing T cell activation inhibitor 1
    • V-set domain-containing T-cell activation inhibitor 1
    • VCTN1
    • Vtcn1
    • VTCN1_HUMAN
    see all
  • Function

    Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.
  • Tissue specificity

    Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, including in kidney, liver, lung, ovary, placenta, spleen and testis.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane. Expressed at the cell surface. A soluble form has also been detected.
  • Information by UniProt

References

ab215003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up