Recombinant Human B7H4 protein (denatured) (ab174433)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSLIIGFGISGRHSITVTTVASAGNIGED GILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRT AVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFS MPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFEL NSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHL QLLNSKAS
    • Molecular weight
      28 kDa including tags
    • Amino acids
      25 to 259
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Extracellular domain. NCBI Accession No.: NP_078902

Specifications

Our Abpromise guarantee covers the use of ab174433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • B7 family member, H4
    • B7 H4
    • B7 homolog 4
    • B7 superfamily member 1
    • B7 superfamily, member 1
    • B7-H4
    • B7h.5
    • B7h4
    • B7S1
    • B7x
    • BC032925
    • Immune costimulatory protein B7-H4
    • Immune costimulatory protein B7H4
    • MGC41287
    • PRO1291
    • Protein B7S1
    • RP11 229A19.4
    • T cell costimulatory molecule B7x
    • T-cell costimulatory molecule B7x
    • V set domain-containing T cell activation inhibitor 1
    • V-set domain-containing T-cell activation inhibitor 1
    • VCTN1
    • Vtcn1
    • VTCN1_HUMAN
    see all
  • Function
    Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.
  • Tissue specificity
    Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, including in kidney, liver, lung, ovary, placenta, spleen and testis.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane. Expressed at the cell surface. A soluble form has also been detected.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174433 (3 µg)

References

ab174433 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up