Overview

  • Product name
    Recombinant Human BAAT protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NGTNFPFGIPQVYHGQIHQPLPHSAQLISTNALGLLELYRTFETTQVGAS QYLFPIEEAQGQFLFIVGEGDKTINSKAHAEQAIGQLKRHGKNNWTLL
    • Amino acids
      258 to 355
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20300
    • BAAT
    • BAAT_HUMAN
    • BACAT
    • BAT
    • Bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase)
    • Bile acid CoA:amino acid N acyltransferase
    • Bile acid Coenzyme A amino acid N acyltransferase glycine N choloyltransferase
    • Bile acid Coenzyme A: amino acid N acyltransferase
    • Bile acid-CoA:amino acid N-acyltransferase
    • Glycine N choloyltransferase
    • Glycine N-choloyltransferase
    • Long chain fatty acyl CoA hydrolase
    • Long-chain fatty-acyl-CoA hydrolase
    • MGC104432
    see all
  • Function
    Involved in bile acid metabolism. In liver hepatocytes catalyzes the second step in the conjugation of C24 bile acids (choloneates) to glycine and taurine before excretion into bile canaliculi. The major components of bile are cholic acid and chenodeoxycholic acid. In a first step the bile acids are converted to an acyl-CoA thioester, either in peroxisomes (primary bile acids deriving from the cholesterol pathway), or cytoplasmic at the endoplasmic reticulum (secondary bile acids). May catalyze the conjugation of primary or secondary bile acids, or both. The conjugation increases the detergent properties of bile acids in the intestine, which facilitates lipid and fat-soluble vitamin absorption. In turn, bile acids are deconjugated by bacteria in the intestine and are recycled back to the liver for reconjugation (secondary bile acids). May also act as an acyl-CoA thioesterase that regulates intracellular levels of free fatty acids. In vitro, catalyzes the hydrolysis of long- and very long-chain saturated acyl-CoAs to the free fatty acid and coenzyme A (CoASH), and conjugates glycine to these acyl-CoAs.
  • Tissue specificity
    Expressed in liver, gallbladder mucosa and pancreas.
  • Involvement in disease
    Defects in BAAT are involved in familial hypercholanemia (FHCA) [MIM:607748]. FHCA is a disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption.
  • Sequence similarities
    Belongs to the C/M/P thioester hydrolase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab157951 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up