For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-bace1-protein-fc-chimera-ab168902.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurology process Neurodegenerative disease Alzheimer's disease Proteases
Share by email

Recombinant Human BACE1 protein (Fc Chimera) (ab168902)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human BACE1 protein (Fc Chimera) (ab168902)

    Key features and details

    • Expression system: HEK 293 cells
    • Purity: > 85% SDS-PAGE
    • Endotoxin level: < 1.000 Eu/µg
    • Tags: Fc tag N-Terminus
    • Suitable for: SDS-PAGE

    You may also be interested in

    ELISA
    Product image
    Human BACE-1 ELISA Kit (ab267637)

    View more associated products

    Description

    • Product name

      Recombinant Human BACE1 protein (Fc Chimera)
      See all BACE1 proteins and peptides
    • Purity

      > 85 % SDS-PAGE.

    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      HEK 293 cells
    • Accession

      P56817
    • Protein length

      Protein fragment
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        TQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKS GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY RDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFI NGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFP LNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEING QDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDG FWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVE DVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACH VHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMT
      • Predicted molecular weight

        75 kDa including tags
      • Amino acids

        22 to 457
      • Tags

        Fc tag N-Terminus
      • Additional sequence information

        The Human BACE-1 will be further processed into mature form (Glu 46-Thr 457). The protein has a calculated MW of 75.2 kDa (pro-form) and 72.6 kDa (mature-form).

    Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab168902 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        SDS-PAGE

      • Form

        Lyophilized
      • Additional notes

        This product is stable after storage at:

        • -20°C to -70°C for 12 months in lyophilized state;
        • -70°C for 3 months under sterile conditions after reconstitution.
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

        pH: 7.4
        Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris

      • Reconstitution
        Reconstitute with sterile deionized water to a concentration of 1 mg/ml.

      General Info

      • Alternative names

        • APP beta secretase
        • Asp 2
        • ASP2
        • Aspartyl protease 2
        • BACE
        • BACE 1
        • BACE1
        • BACE1_HUMAN
        • Beta secretase
        • Beta secretase 1
        • Beta site amyloid beta A4 precursor protein cleaving enzyme
        • Beta site amyloid precursor protein cleaving enzyme
        • Beta site amyloid precursor protein cleaving enzyme 1
        • Beta site APP cleaving enzyme
        • Beta site APP cleaving enzyme 1
        • Beta-secretase 1
        • Beta-site amyloid precursor protein cleaving enzyme 1
        • Beta-site APP cleaving enzyme 1
        • FLJ90568
        • HSPC104
        • Memapsin 2
        • Memapsin-2
        • Memapsin2
        • Membrane associated aspartic protease 2
        • Membrane-associated aspartic protease 2
        • Transmembrane aspartic proteinase Asp2
        see all
      • Function

        Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cleaves at the N-terminus of the A-beta peptide sequence, between residues 671 and 672 of APP, leads to the generation and extracellular release of beta-cleaved soluble APP, and a corresponding cell-associated C-terminal fragment which is later released by gamma-secretase.
      • Tissue specificity

        Expressed at high levels in the brain and pancreas. In the brain, expression is highest in the substantia nigra, locus coruleus and medulla oblongata.
      • Sequence similarities

        Belongs to the peptidase A1 family.
      • Domain

        The transmembrane domain is necessary for its activity. It determines its late Golgi localization and access to its substrate, APP.
      • Post-translational
        modifications

        Glycosylated.
      • Cellular localization

        Membrane. Golgi apparatus > trans-Golgi network. Endoplasmic reticulum. Endosome. Cell surface. Predominantly localized to the later Golgi/trans-Golgi network (TGN) and minimally detectable in the early Golgi compartments. A small portion is also found in the endoplasmic reticulum, endosomes and on the cell surface.
      • Target information above from: UniProt accession P56817 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

      Images

      • SDS-PAGE - Recombinant Human BACE1 protein (Fc Chimera) (ab168902)
        SDS-PAGE - Recombinant Human BACE1 protein (Fc Chimera) (ab168902)

        SDS-PAGE analysis of reduced ab168902 stained overnight with Coomassie Blue. The protein ab168902 migrates as 80-96 kDa due to glycosylation.

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      Datasheets and documents

      • SDS download

      • Datasheet download

        Download

      References (0)

      Publishing research using ab168902? Please let us know so that we can cite the reference in this datasheet.

      ab168902 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab168902.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.