Description

  • Product name

    Recombinant Human BACE2 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYF PKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYR
    • Amino acids

      306 to 395
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153246 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ALP 56
    • ALP56
    • Asp 1
    • ASP1
    • ASP21
    • Aspartic Like Protease 56kDa
    • Aspartic-like protease 56 kDa
    • Aspartyl protease 1
    • BACE 2
    • Bace2
    • BACE2_HUMAN
    • Beta Secretase 2
    • Beta Site Amyloid Beta A4 Precursor Protein Cleaving Enzyme 2
    • Beta-secretase 2
    • Beta-site amyloid precursor protein cleaving enzyme 2
    • Beta-site APP cleaving enzyme 2
    • Down region aspartic protease
    • Downs Syndrome Region Aspartic Protease
    • DRAP
    • Memapsin 1
    • Memapsin-1
    • Membrane associated aspartic protease 1
    • Membrane-associated aspartic protease 1
    • Theta-secretase
    see all
  • Function

    Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cleaves APP, between residues 690 and 691, leading to the generation and extracellular release of beta-cleaved soluble APP, and a corresponding cell-associated C-terminal fragment which is later released by gamma-secretase. It has also been shown that it can cleave APP between residues 671 and 672.
  • Tissue specificity

    Brain. Present in neurons within the hippocampus, frontal cortex and temporal cortex (at protein level). Expressed at low levels in most peripheral tissues and at higher levels in colon, kidney, pancreas, placenta, prostate, stomach and trachea. Expressed at low levels in the brain. Found in spinal cord, medulla oblongata, substantia nigra and locus coruleus. Expressed in the ductal epithelium of both normal and malignant prostate.
  • Sequence similarities

    Belongs to the peptidase A1 family.
  • Post-translational
    modifications

    Undergoes autoproteolytic cleavage.
    Glycosylated.
  • Cellular localization

    Membrane. Golgi apparatus. Endoplasmic reticulum. Endosome. Cell surface.
  • Information by UniProt

Images

  • ab153246 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153246 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153246.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up