Overview

  • Product name

    Recombinant Human BACH2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      RKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDIQSPEQIQALHR YCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL
    • Amino acids

      679 to 770
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Bach 2
    • Bach2
    • BACH2_HUMAN
    • Basic leucine zipper transcription factor 2
    • BTB and CNC homolog 2
    • BTB and CNC homology 1 basic leucine zipper transcription factor 2
    • BTB domain and CNC homolog 2
    • BTBD25
    • OTTHUMP00000016867
    • OTTHUMP00000016868
    • OTTHUMP00000040591
    • Transcription regulator protein BACH2
    see all
  • Function

    Transcriptional regulator that acts as repressor or activator. Binds to Maf recognition elements (MARE). Play important roles in coordinating transcription activation and repression by MAFK.
  • Tissue specificity

    B-cell specific.
  • Sequence similarities

    Belongs to the bZIP family. CNC subfamily.
    Contains 1 BTB (POZ) domain.
    Contains 1 bZIP domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153475 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up