Description

  • Product name

    Recombinant Human BAG2 protein
  • Purity

    > 95 % SDS-PAGE.
    ab104795 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAQAKINAKANEGRFCRSSSMADRSSRLLE SLDQLELRVEALREAATAVEQEKEILLEMIHSIQNSQDMRQISDGEREEL NLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEVVNKFLDDLGN AKSHLMSLYSACSSEVPHGPVDQKFQSIVIGCALEDQKKIKRRLETLLRN IENSDKAIKLLEHSKGAGSKTLQQNAESRFN
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      1 to 211
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • BAG 2
    • BAG family molecular chaperone regulator 2
    • BAG-2
    • BAG-family molecular chaperone regulator-2
    • Bag2
    • BAG2_HUMAN
    • BCL 2 associated athanogene 2
    • Bcl-2-associated athanogene 2
    • BCL2 associated athanogene 2
    • BCL2-associated athanogene 2
    • dJ417I1.2
    • dJ417I1.2 (BAG family molecular chaperone regulator 2)
    • KIAA0576
    • MGC149462
    • OTTHUMP00000016668
    see all
  • Function

    Inhibits the chaperone activity of HSP70/HSC70 by promoting substrate release.
  • Sequence similarities

    Contains 1 BAG domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab104795.

References

ab104795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up