Description

  • Product name

    Recombinant Human BAIAP2L1/IRTKS protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KLLEENETEAVTVPTPSPTPVRSISTVNLSENSSVVIPPPDYLECLSMGA AADRRADSARTTSTFKAPASKPETAAPNDANGTAKPPFLSGENPFATVKL RPTVTNDRSAPIIR
    • Amino acids

      398 to 511
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as BAIAP2L1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BAI1 associated protein 2 like 1
    • BAI1 associated protein 2 like protein 1
    • BAI1-associated protein 2-like protein 1
    • Baiap2l1
    • BI2L1_HUMAN
    • Brain specific angiogenesis inhibitor 1 associated protein 2 like protein 1
    • Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1
    • FLJ42275
    • Insulin receptor tyrosine kinase substrate
    • IRTKS
    see all
  • Function

    May function as adapter protein. Involved in the formation of clusters of actin bundles. Plays a role in the reorganization of the actin cytoskeleton in response to bacterial infection.
  • Sequence similarities

    Contains 1 IMD (IRSp53/MIM homology) domain.
    Contains 1 SH3 domain.
  • Domain

    The IMD domain is predicted to have a helical structure. It may induce actin bundling and filopodia formation.
  • Post-translational
    modifications

    Phosphorylated on tyrosine in response to insulin.
  • Cellular localization

    Cytoplasm, cytoskeleton. Recruited to actin pedestals that are formed upon infection by bacteria at bacterial attachment sites.
  • Information by UniProt

Images

  • ab163288 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up