Description

  • Product name

    Recombinant Human Band 3/AE 1 protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTS HPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLS HLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDR EELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLF CEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEA AELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYM AQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS PAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDA FSP
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      1 to 403
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Cytoplasmic domain. N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab235968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Band 3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • AE 1
    • AE1
    • Anion exchange protein 1
    • Anion exchanger 1
    • B3AT_HUMAN
    • Band 3
    • Band 3 anion transport protein
    • BND3
    • CD233
    • DI
    • Diego blood group
    • EMPB3
    • EPB3
    • Erythrocyte membrane protein band 3
    • Erythroid anion exchange protein
    • FR
    • Froese blood group
    • RTA1A
    • SLC4A1
    • Solute carrier family 4 anion exchanger member 1
    • Solute carrier family 4 member 1
    • SW
    • Swann blood group
    • Waldner blood group
    • WD
    • WD1
    • WR
    • Wright blood group
    see all
  • Function

    Functions both as a transporter that mediates electroneutral anion exchange across the cell membrane and as a structural protein. Major integral membrane glycoprotein of the erythrocyte membrane; required for normal flexibility and stability of the erythrocyte membrane and for normal erythrocyte shape via the interactions of its cytoplasmic domain with cytoskeletal proteins, glycolytic enzymes, and hemoglobin. Functions as a transporter that mediates the 1:1 exchange of inorganic anions across the erythrocyte membrane. Mediates chloride-bicarbonate exchange in the kidney, and is required for normal acidification of the urine.
  • Tissue specificity

    Detected in erythrocytes (at protein level) (PubMed:7506871, PubMed:26542571). Isoform 2 is expressed in kidney (at protein level) (PubMed:7506871).
  • Involvement in disease

    Ovalocytosis, Southeast Asian
    Spherocytosis 4
    Renal tubular acidosis, distal, autosomal dominant
    Renal tubular acidosis, distal, with hemolytic anemia
    Renal tubular acidosis, distal, with normal red cell morphology
    Cryohydrocytosis
  • Sequence similarities

    Belongs to the anion exchanger (TC 2.A.31) family.
  • Post-translational
    modifications

    Phosphorylated on Tyr-8 and Tyr-21 most likely by SYK. PP1-resistant phosphorylation that precedes Tyr-359 and Tyr-904 phosphorylation.
    Phosphorylated on Tyr-359 and Tyr-904 most likely by LYN. PP1-inhibited phosphorylation that follows Tyr-8 and Tyr-21 phosphorylation.
    N-glycosylated.
  • Cellular localization

    Cell membrane. Basolateral cell membrane. Detected in the erythrocyte cell membrane and on the basolateral membrane of alpha-intercalated cells in the collecting duct in the kidney.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235968.

References

ab235968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up