Overview

  • Product name

    Recombinant Human BANP protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MMSEHDLADVVQIAVEDLSPDHPVVLENHVVTDEDEPALKRQRLEINCQD PSIKSFLYSINQTICLRLDSIEAKLQALEATCKSLEEKLDLVTNKQHSPI QVPMVAGSPLGATQTCNKVRCAVPGRRQNTIVVKVPGQEDSHHEDGESGS EASDSVSSCGQAGSQSIGSNVTLITLNSEEDYPNGTWLGDENNPEMRVRC AIIPSDMLHISTNCRTAEKMALTLLDYLFHREVQAVSNLSGQGKHGKKQL DPLTIYGIRCHLFYKFGITESDWYRIKQSIDSKCRTAWRRKQRGQSLAVK SFSRRTPNSSSYCPSEPMMSTPPPASELPQPQPQPQALHYALANAQQVQI HQIGEDGQVQVIPQGHLHIAQVPQGEQVQITQDSEGNLQIHHVGQDGQVL QGAQLIAVASSDPAAAGVDGSPLQGSDIQVQYVQLAPVSDHTAGAQTAEA LQPTLQPEMQLEHGAIQIQ
    • Molecular weight

      78 kDa including tags
    • Amino acids

      1 to 469

Specifications

Our Abpromise guarantee covers the use of ab132284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AAH09424
    • Banp
    • BANP_HUMAN
    • BEN domain-containing protein 1
    • BEND1
    • BTG3 associated nuclear protein isoform a
    • Btg3-associated nuclear protein
    • DKFZp761H172
    • FLJ 10177
    • FLJ 20538
    • FLJ10177
    • FLJ20538
    • Protein BANP
    • Scaffold/Matrix associated region 1
    • Scaffold/matrix-associated region-1-binding protein
    • SMAR 1
    • SMAR1
    • SMARBP 1
    • SMARBP1
    see all
  • Function

    Controls V(D)J recombination during T-cell development by repressing T-cell receptor (TCR) beta enhancer function. Binds to scaffold/matrix attachment region beta (S/MARbeta), an ATC-rich DNA sequence located upstream of the TCR beta enhancer. Represses cyclin D1 transcription by recruiting HDAC1 to its promoter, thereby diminishing H3K9ac, H3S10ph and H4K8ac levels. Promotes TP53 'Ser-15' phosphorylation and nuclear accumulation, which causes cell cycle arrest.
  • Tissue specificity

    Down-regulated in breast cancer cell lines.
  • Sequence similarities

    Belongs to the BANP/SMAR1 family.
    Contains 1 BEN domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132284.

References

ab132284 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up