Overview

  • Product name

    Recombinant Human BAP31 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNT FFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQ RNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKY MEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQ KLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
    • Molecular weight

      54 kDa including tags
    • Amino acids

      1 to 246

Specifications

Our Abpromise guarantee covers the use of ab132144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 6C6 AG
    • 6C6 AG tumor associated antigen
    • 6C6-AG tumor-associated antigen
    • 6C6AG
    • 6C6AG tumor associated antigen
    • Accessory protein BAP 31
    • Accessory protein BAP31
    • B cell receptor associated protein 31
    • B-cell receptor-associated protein 31
    • BA31
    • BAP 31
    • Bap31
    • BAP31_HUMAN
    • BCAP 31
    • BCAP31
    • BCR associated protein Bap 31
    • BCR associated protein Bap31
    • BCR-associated protein 31
    • CDM
    • CDM protein
    • DXS1357E
    • MS950
    • p28
    • p28 Bap31
    • Protein CDM
    • RP23-329M9.5
    see all
  • Function

    May play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. May be involved in CASP8-mediated apoptosis.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Note=BCAP31 is deleted in the chromosome Xq28 deletion syndrome which involves BCAP31 and the and the promoter region of ABCD1.
  • Sequence similarities

    Belongs to the BCAP29/BCAP31 family.
  • Post-translational
    modifications

    Cleaved by CASP8 and other caspases.
  • Cellular localization

    Endoplasmic reticulum membrane. Endoplasmic reticulum-Golgi intermediate compartment membrane. May shuttle between the ER and the intermediate compartment/cis-Golgi complex.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132144 stained with Coomassie Blue.

References

ab132144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up