Overview

  • Product name
    Recombinant Human BarH2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHESFRPKLEQEDSKTK LDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRK
    • Amino acids
      145 to 234
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BARH LIKE 2
    • BarH like 2 homeobox protein
    • BARHL2
  • Relevance
    The Drosophila BarH1 and BarH2 (Bar) genes are homeobox containing genes, which are required for the fate determination of external sensory organs in the fly. Using a bioinformatic approach, murine and human homeobox genes highly related to the Bar Drosophila genes were identified, which were designated Barhl1 and Barhl2. Murine Barhl2 is the homolog of the rat mBH1 gene. The human BARHL2 fragment shares 92% and 74% nucleotide identity, respectively, with the rat mBH1 and human BARHL1 cDNA sequences.
  • Cellular localization
    Nuclear

Images

  • ab166307 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up