Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQ RSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEK MCPLLLCPMNFVPVPPRPDPVAGCLPR
    • Amino acids
      1 to 127
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163105 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 21 kD small nuclear factor isolated from T cells
    • 21 kDa small nuclear factor isolated from T-cells
    • ATF like 3
    • B-ATF-3
    • basic leucine zipper transcription factor, ATF-like 3
    • BATF3
    • FLJ36352
    • FLJ37535
    • hCG 39202
    • JDP1
    • Jun dimerization protein 1
    • Jun dimerization protein p21SNFT
    • JUNDM1
    • SNFT
    see all
  • Relevance
    BATF3 belongs to the bZIP family and contains 1 bZIP domain. Functions as a negative regulator of AP-1-mediated transcription by heterodimerizing with JUN and binding DNA at 12-O-tetradecanoylphorbol-13-acetate response elements (TRE) (consensus: 5'-TGA[CG]TCA-3'). Represses IL2 and MMP1 promoter activities.
  • Cellular localization
    Nuclear

Images

  • ab163105 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163105 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163105.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up