Description

  • Product name

    Recombinant Human BAZ2A/TIP5 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQKRKSGYSLNFSEGD GRRRRVLLKGRESPAAGPRYSEERLSPSKRRRLSMRNHHSDLTFCEIILM
    • Amino acids

      1681 to 1780
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as BAZ2A

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Bromodomain adjacent to zinc finger domain 2A
    • Tip5
    • Transcription termination factor I interacting protein 5
    • TTF I interacting protein 5
    • WALp3
    see all
  • Relevance

    BAZ2A is a bromodomain adjacent to a zinc finger domain protein. It may play a role in transcriptional regulation interacting with ISWI and may serve a specific role in maintaining or altering the chromatin structure of the rDNA locus. BAz2A colocalizes with the basal RNA polymerase I transcription factor UBF in the nucleolus.
  • Cellular localization

    Nuclear

Images

  • ab161337 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161337 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161337.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up