Overview

  • Product name

    Recombinant human BAZ2B protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MHHHHHHSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPG YKKVIKKPMDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDI GRAGHNMRKYFEKKWTDTFKVS
    • Molecular weight

      14 kDa including tags
    • Amino acids

      2054 to 2168
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Corresponding to single bromodomain.

Specifications

Our Abpromise guarantee covers the use of ab196402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    >= 84 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • BAZ2B
    • BAZ2B_HUMAN
    • Bromodomain adjacent to zinc finger domain 2B
    • Bromodomain adjacent to zinc finger domain protein 2B
    • DKFZp434H071
    • DKFZp762I0516
    • FLJ45644
    • hWALp4
    • OTTHUMP00000162897
    • OTTHUMP00000162898
    • WALp4
    see all
  • Function

    May play a role in transcriptional regulation interacting with ISWI.
  • Tissue specificity

    Expressed at varying levels in several tissues, whereas a smaller transcript was expressed specifically in testis.
  • Sequence similarities

    Belongs to the WAL family.
    Contains 1 bromo domain.
    Contains 1 DDT domain.
    Contains 1 MBD (methyl-CpG-binding) domain.
    Contains 1 PHD-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • Example of specific activity of ab196402.

  • 4-20% SDS-PAGE analysis of ab196402 (5 μg) with Coomassie staining.

References

ab196402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up