Description

  • Product name

    Recombinant Human BBF2H7 protein
  • Purity

    > 90 % SDS-PAGE.
    ab202158 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMEVLESGEQGVLQWDRKLSELSEPGDG EALMYHTHFSELLDEFSQNVLGQLLNDPFLSEKSVSMEVEPSPTSPAPLI QAEHSYSLCEEPRAQSPFTHITSDSFNDDEVESEKWYLSTDFPSTSIKTE PITDEPPPGLVPSVTLTITAISTPLEKEEPPLEMNTGVDSSCQTIIPKIK LEPHEVDQFLNFSPKEAPVDHLHLPPTPPSSHGSDSEGSLSPNPRLHPFS LPQTHSPSRAAPRAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEG YPIPTKLPLSKSEEKALKKIRRKIKNKISAQESRRKKKEYMDSLEKKVES CSTENLELRKKVEVLENTNRTLLQQLQKLQTLVMGKVSRTCKLAGTQTGT C
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      1 to 378
    • Tags

      His tag N-Terminus
    • Additional sequence information

      AAI10814.

Specifications

Our Abpromise guarantee covers the use of ab202158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as CREB3L2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 50% Glycerol, 0.02% DTT, 0.32% Tris HCl

General Info

  • Alternative names

    • B ZIB transcription factor
    • Basic transcription factor 2
    • BBF2 human homolog on chromosome 7
    • BBF2H7
    • BZIB transcription factor
    • cAMP responsive element binding protein 3 like 2
    • cAMP-responsive element-binding protein 3-like protein 2
    • CR3L2_HUMAN
    • Creb3l2
    • Cyclic AMP-responsive element-binding protein 3-like protein 2
    • FUS/BBF2H7 protein
    • MGC131709
    • MGC71006
    • Processed cyclic AMP-responsive element-binding protein 3-like protein 2
    • TCAG_1951439
    see all
  • Function

    Transcriptional activator which is processed and activated during endoplasmic reticulum stress late phase. Binds to the cAMP response element (CRE) and activates transcription through CRE. Regulates the transcription of unfolded protein response target genes, preventing accumulation of unfolded proteins in damaged neurons. Also regulates the expression of SEC23A, accelerating protein trafficking from the ER to the Golgi thereby playing a key role in chondrocyte differentiation and formation of epiphyseal cartilage.
  • Tissue specificity

    Widely expressed with highest levels in placenta, lung, spleen and intestine, and lowest levels in heart, brain, skeletal muscle, thymus, colon and leukocytes. In fetal tissues, the weakest expression is detected in brain and heart.
  • Involvement in disease

    A chromosomal aberration involving CREB3L2 is found in low grade fibromyxoid sarcoma (LGFMS). Translocation t(7;16)(q33;p11) with FUS.
  • Sequence similarities

    Belongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP (basic-leucine zipper) domain.
  • Post-translational
    modifications

    Controlled by regulated intramembrane proteolysis (RIP). Following ER stress a fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases (PS1 and PS2).
  • Cellular localization

    Endoplasmic reticulum membrane and Nucleus. Under ER stress the cleaved N-terminal cytoplasmic domain translocates into the nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202158 (3µg).

References

ab202158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up