Description

  • Product name

    Recombinant Human BBOX1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKA RKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQA RAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIV RLTGASDKPGEVSKLGKRMGFLYLTFYGHTWQVQDKIDANNVAYTTGKLS FHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQ ILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIF DVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRR SYEAGTEISRHLEGAYADWDVVMSRLRILRQRVENGN
    • Predicted molecular weight

      68 kDa including tags
    • Amino acids

      1 to 387

Specifications

Our Abpromise guarantee covers the use of ab132599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2-oxoglutarate dioxygenase
    • BBH
    • BBOX
    • BBOX 1
    • Bbox1
    • BODG_HUMAN
    • Butyrobetaine (gamma) 2 oxoglutarate dioxygenase (gamma butyrobetaine hydroxylase) 1
    • G BBH
    • Gamma BBH
    • Gamma butyrobetaine 2 oxoglutarate dioxygenase 1
    • Gamma butyrobetaine dioxygenase
    • Gamma butyrobetaine hydroxylase
    • Gamma-BBH
    • Gamma-butyrobetaine
    • Gamma-butyrobetaine dioxygenase
    • Gamma-butyrobetaine hydroxylase
    see all
  • Function

    Catalyzes the formation of L-carnitine from gamma-butyrobetaine.
  • Tissue specificity

    Highly expressed in kidney; moderately expressed in liver; very low expression in brain.
  • Pathway

    Amine and polyamine biosynthesis; carnitine biosynthesis.
  • Sequence similarities

    Belongs to the gamma-BBH/TMLD family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132599 stained with Coomassie Blue.

References

ab132599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up